PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN33444.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 285aa    MW: 31372 Da    PI: 7.6728
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN33444.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.73e-392484262
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                +e+alkcprCdst tkfCyynnyslsqPryfCk+C+ryWtkGG+lrnvPvGgg+rk+++ss
  KHN33444.1 24 PEQALKCPRCDSTSTKFCYYNNYSLSQPRYFCKSCKRYWTKGGTLRNVPVGGGCRKKRSSS 84
                6899*****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-272281IPR003851Zinc finger, Dof-type
PfamPF027013.6E-332682IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7332882IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103066IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MDPSNGQPQQ MSSQSVEKKP KPHPEQALKC PRCDSTSTKF CYYNNYSLSQ PRYFCKSCKR  60
YWTKGGTLRN VPVGGGCRKK RSSSKRAQDQ TFTPNLNPLT ALPHLSYDSN DLTLALARFQ  120
KQSSGQLGYN DHDLSIMGNP TTGSFCDILG NSGMNPSSEN PSFLDEFQTG FLQTQNHLQN  180
LYCVYGNGDL GEVDNGNSGG VGVSGEMMLP YDQVVMSNAT AQSVSVMKQE MCSGREQSER  240
RVLGGFPWQI NADTNIIGEL DSGKAIASWN SFTNSWHGLL QSPLM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572610.0DQ857261.1 Glycine max Dof11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003547515.10.0PREDICTED: dof zinc finger protein DOF5.3-like
TrEMBLA0A0B2RM930.0A0A0B2RM93_GLYSO; Dof zinc finger protein DOF2.1
TrEMBLK7M9L00.0K7M9L0_SOYBN; Uncharacterized protein
STRINGGLYMA15G04980.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50263051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28510.14e-41Dof family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]